PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G146600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 360aa    MW: 38024 Da    PI: 9.5699
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G146600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.4e-192570147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W++eEde l ++v+++G ++W++I+r ++ gR++k+c++rw + 
  Sevir.2G146600.1.p 25 KGPWSPEEDEALQRLVARHGARNWSLISRSIP-GRSGKSCRLRWCNQ 70
                        79******************************.***********985 PP

2Myb_DNA-binding51.72e-1679121347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++T++Ed+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Sevir.2G146600.1.p  79 PFTPDEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 121
                         89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.5972075IPR017930Myb domain
SuperFamilySSF466898.61E-3222118IPR009057Homeodomain-like
SMARTSM007178.3E-172473IPR001005SANT/Myb domain
PfamPF002492.4E-182570IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-252678IPR009057Homeodomain-like
CDDcd001675.73E-162769No hitNo description
SMARTSM007177.2E-1476124IPR001005SANT/Myb domain
PROSITE profilePS5129419.74777126IPR017930Myb domain
PfamPF002496.2E-1479121IPR001005SANT/Myb domain
CDDcd001674.93E-1179122No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2379125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MASSSSSPSC RAGGAGGKPD VDRIKGPWSP EEDEALQRLV ARHGARNWSL ISRSIPGRSG  60
KSCRLRWCNQ LSPQVEHRPF TPDEDDTILR AHARFGNKWA TIARLLSGRT DNAIKNHWNS  120
TLKRKYYAAA GSGCGAAGPA AAADADDERP LKRTSSDGHP GLCFSPGSPS GSDLSDSSHH  180
SLPSVMPSAA PAVTSQQQQH VYRPVPRAGG VVVLPPPLAP RPPSPPPQAP PPPATSLSLS  240
LSLPGLDQQA DPSPSPPPVQ MQQQQPAPSQ MPPPPPPPPT QPSLPFQLEP PAMNLASPRL  300
PPPPQSPAPF SAEFLSMMQE MIRIEVRNYM SGSGLDPRAD AGAAVHAVSK RMMGMAKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-39171251107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794250.0HF679425.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB19 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699597.21e-164PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like
TrEMBLK4A1P51e-160K4A1P5_SETIT; Uncharacterized protein
STRINGSi032789m1e-159(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-65myb domain protein 73